Web Analysis for Vishwakarmaelectricalappliances - vishwakarmaelectricalappliances.com
ISHWAKARMA ELECTRIC APPLIANCES - Manufacturer,Supplier Of Electric Appliances,Electrical Goods,Home Appliances In New Delhi,India
vishwakarmaelectricalappliances.com is 6 years 1 month old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, vishwakarmaelectricalappliances.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 1 |
H3 Headings: | 3 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 21 |
Google Adsense: | Not Applicable | Google Analytics: | UA-99066560-1 |
Websites Hosted on Same IP (i.e. 104.199.153.189)
Cotton Leggings Supplier Punjab,Ladies Cotton Leggings Manufacturer In
Supplier,manufacturer of Cotton Leggings,Ladies Cotton Leggings from PUNEET KNIT FAB. Buy Cotton Leggings,Ladies Cotton Leggings online at best prices from Ludhiana,Punjab,India
Building Materials Exporter,HDPE Injection Molded Fittings,Plastic Pip
Contact SAHARA EMIRATES TRADING - Who is a supplier,trader and exporter of the products like building materials,HDPE injection molded fittings,plastic pipes and much more.
Jersey Cow,India Jersey Cow,Jersey Cow Supplier,Trader,India
We, RULHAN DAIRY FARMS is one of the leading supplier,trader of hybrid Cattle like Jersey Cow,India Jersey Cow,Friesian Cow,Holstein Friesian Cow from Karnal, India
Ampoule Filling Machine Manufacturer,Ampoule Sealing Machine Manufactu
Visit the online business catalog of HARSIDDH ENGINEERING CO. - Leading manufacturer, exporter & supplier of ampoule filling machine & ampoule sealing machine from Ahmedabad,Gujarat,India
Bopp self adhesive tapes supplier,self adhesive packaging tapes manufa
ABM International - Manufacturer,supplier and exporter of Bopp self adhesive tapes,self adhesive packaging tapes,pressure adhesive tapes,carton sealing bopp tapes,colored bopp tape,scotch tape,surface protection films from India
HTTP Header Analysis
Date: Fri, 30 Mar 2018 19:18:20 GMT
Server: Apache/2.4.10 (Debian)
X-Tradeindia-Request-GUID: modperl-www-group-252v]-b53b40ed-bc8f-471e-a7f6-3157dc1f0fc0
X-Tradeindia-SMgmt: Yes
Content-Type: text/html
Via: 1.1 catalogs.tradeindia.com
Vary: Accept-Encoding
Content-Encoding: gzip
Connection: close
Transfer-Encoding: chunked
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
server1.trade-india.com | 34.93.53.150 | India | |
server2.trade-india.com | 35.200.224.247 | India |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
vishwakarmaelectricalappliances.com | A | 300 |
IP: 104.199.153.189 |
vishwakarmaelectricalappliances.com | NS | 300 |
Target: ns.tradeindia.com |
vishwakarmaelectricalappliances.com | SOA | 38400 |
MNAME: server1.trade-india.com RNAME: sysadmin.tradeindia.com Serial: 2018022900 Refresh: 10800 Retry: 3600 Expire: 604800 Minimum TTL: 3600 |
vishwakarmaelectricalappliances.com | MX | 300 |
Priority: 10 Target: mx.vishwakarmaelectricalappliances.com.cust.a.hostedemail.com |
vishwakarmaelectricalappliances.com | TXT | 300 |
TXT: v=spf1 include:_spf.hostedemail.com ~all |
Full WHOIS Lookup
Registry Domain ID: 2245190923_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucowsdomains.com
Updated Date: 2018-03-29T12:33:30Z
Creation Date: 2018-03-29T12:33:30Z
Registry Expiry Date: 2023-03-29T12:33:30Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: SERVER1.TRADE-INDIA.COM
Name Server: SERVER2.TRADE-INDIA.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-03-30T19:18:14Z